AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-GPR155 Antibody
상품 한눈에 보기
Human GPR155 단백질을 인식하는 Rabbit Polyclonal 항체로, PrEST 항원을 이용해 친화정제됨. IHC 등 다양한 응용에 적합하며, 높은 종간 보존성을 보임. DEPDC3, PGR22 등 대체 유전자명으로도 알려짐.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA057384-100 Anti-GPR155 Antibody, G protein-coupled receptor 155 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA057384-25 Anti-GPR155 Antibody, G protein-coupled receptor 155 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-GPR155 Antibody
Anti-GPR155 Antibody
Target Information
- Target Protein: G protein-coupled receptor 155
- Target Gene: GPR155
- Alternative Gene Names: DEP.7, DEPDC3, FLJ31819, PGR22
Product Description
Polyclonal antibody against human GPR155, generated in rabbit and affinity purified using the PrEST antigen as ligand.
Recommended Applications
- Immunohistochemistry (IHC)
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
- Antigen Sequence:
HLIILPFKRRLEFLWNNKDTAENRDSPVSEEIKMTCQQFIHYHRDLCIRNIVKERRCGAKTSAGTFCGCDLVSW
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000018485 | 92% |
| Mouse | ENSMUSG00000041762 | 89% |
Antibody Characteristics
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
- 40% glycerol and PBS (pH 7.2)
- 0.02% sodium azide (preservative)
- Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.