Atlas Antibodies Anti-GPR150 Antibody

상품 한눈에 보기

Human GPR150을 타겟으로 하는 Rabbit Polyclonal Antibody. Affinity purification 방식으로 제조되어 높은 특이성과 재현성을 제공. IHC 등 다양한 연구 응용에 적합. PBS/glycerol buffer에 보존제로 sodium azide 포함.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA026635-100 Anti-GPR150 Antibody, G protein-coupled receptor 150 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA026635-25 Anti-GPR150 Antibody, G protein-coupled receptor 150 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-GPR150 Antibody

Anti-GPR150 Antibody

Target Information

Target Protein: G protein-coupled receptor 150
Target Gene: GPR150
Alternative Gene Names: PGR11

Product Description

Polyclonal Antibody against Human GPR150.

Recommended Applications

면역조직화학(IHC) 등 다양한 연구용 응용에 적합합니다.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
GDCRLRRQLRKRLGSLCCAPQGGAEDEEGPRGHQALYRQRWPHPHYHHARREPLDEGGLRPPPPRPRPLPCSCESAF

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000026944 (73%)
Mouse ENSMUSG00000045509 (69%)

Specifications

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand