CacheBy
Atlas Antibodies Anti-GPR108 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-GPR108 Antibody

상품 한눈에 보기

Human GPR108 단백질을 인식하는 폴리클로날 항체로, Rabbit 유래 IgG 형식. IHC 및 ICC 응용에 적합하며, PrEST 항원으로 친화 정제됨. 높은 인간 특이성과 안정적인 PBS/glycerol buffer 구성.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA041951-100 Anti-GPR108 Antibody, G protein-coupled receptor 108 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA041951-25 Anti-GPR108 Antibody, G protein-coupled receptor 108 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-GPR108 Antibody

Anti-GPR108 Antibody

Target Information

  • Target Protein: G protein-coupled receptor 108
  • Target Gene: GPR108
  • Alternative Gene Name: LUSTR2

Product Description

Polyclonal antibody against human GPR108.
Affinity purified using the PrEST antigen as affinity ligand.

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

VGFSLSRVRSGRVRSYSTRDFQDCPLQKNSSSFLVLFLINTKDLQVQVRKYGEQKTLFIFPGLLPEAPSKPGLPKPQATVPRKVDG

Verified Species Reactivity

  • Human

Interspecies Information

Species Ortholog ID Sequence Identity
Rat ENSRNOG00000046128 72%
Mouse ENSMUSG00000005823 70%

Antibody Properties

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
Purification Method Affinity purified using PrEST antigen

Material Safety Data Sheet

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources

Open Datasheet (PDF)

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.