Atlas Antibodies Anti-GPR108 Antibody

상품 한눈에 보기

Human GPR108 단백질을 인식하는 폴리클로날 항체로, IHC 및 ICC 등 다양한 면역실험에 적합합니다. Rabbit 유래 IgG 항체이며, PrEST 항원으로 친화 정제되었습니다. 인체 반응성이 검증되어 높은 특이성과 재현성을 제공합니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA041924-100 Anti-GPR108 Antibody, G protein-coupled receptor 108 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA041924-25 Anti-GPR108 Antibody, G protein-coupled receptor 108 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Human G protein-coupled receptor 108 (GPR108)을 표적으로 하는 폴리클로날 항체입니다.
Rabbit 유래 IgG 항체로, PrEST 항원을 사용하여 친화 정제되었습니다.

Polyclonal Antibody against Human GPR108

LUSTR2

항목	내용
Target Protein	G protein-coupled receptor 108
Target Gene	GPR108
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Information	Rat ENSRNOG00000046128 (72%), Mouse ENSMUSG00000005823 (70%)

Antigen Sequence:
VGFSLSRVRSGRVRSYSTRDFQDCPLQKNSSSFLVLFLINTKDLQVQVRKYGEQKTLFIFPGLLPEAPSKPGLPKPQATVPRKVDG

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2). 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand