Atlas Antibodies Anti-GPR107 Antibody

상품 한눈에 보기

Human GPR107 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 RNA-seq 비교를 통한 Orthogonal 검증 수행. 고순도 Affinity 정제 방식 사용. Human에 반응하며 Rat, Mouse와 높은 서열 유사성. 안정한 PBS/glycerol buffer에 보존.

카탈로그번호: HPA031704-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA031704-100 Anti-GPR107 Antibody, G protein-coupled receptor 107 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA031704-25 Anti-GPR107 Antibody, G protein-coupled receptor 107 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-GPR107 Antibody

Anti-GPR107 Antibody

G protein-coupled receptor 107

Recommended Applications

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal antibody against Human GPR107.

Alternative Gene Names

FLJ20998, KIAA1624, LUSTR1, RP11-88G17

Open Datasheet

Target Information

항목	내용
Target Protein	G protein-coupled receptor 107
Target Gene	GPR107
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	KFRPASDNPYLQLSQEEEDLEMESVVTTSGVMESMKKVKKVTNGSVEPQGEWEGSV

Verified Species Reactivity

Human

Interspecies Information

종	Ortholog ID	Antigen Sequence Identity
Rat	ENSRNOG00000023589	88%
Mouse	ENSMUSG00000000194	86%

Antibody Properties

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method	Affinity purified using the PrEST antigen as affinity ligand