
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-GOLIM4 Antibody
상품 한눈에 보기
인간 GOLIM4 단백질을 인식하는 폴리클로날 항체. IHC 및 ICC 응용에 적합하며 RNA-seq 데이터 기반의 정교한 Orthogonal 검증 제공. Rabbit 유래 IgG로 PrEST 항원 친화 정제. 고글지 막 단백질 연구에 최적.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA001677-100 Anti-GOLIM4 Antibody, golgi integral membrane protein 4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA001677-25 Anti-GOLIM4 Antibody, golgi integral membrane protein 4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-GOLIM4 Antibody
Anti-GOLIM4 Antibody
Target: Golgi integral membrane protein 4 (GOLIM4)
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Orthogonal Validation): Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
- ICC: Suitable for immunocytochemistry applications.
Product Description
Polyclonal antibody against human GOLIM4.
Alternative Gene Names
GIMPC, GOLPH4, GPP130, P138
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Golgi integral membrane protein 4 |
| Target Gene | GOLIM4 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse (71%), Rat (70%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative) |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
Antigen Sequence
EHLEEEHDPSPEEQDREWKEQHEQREAANLLEGHARAEVYPSAKPMIKFQSPYEEQLEQQRLAVQQVEEAQQLREHQEALHQQRLQGHLLRQQEQQQQQVAREMALQRQAELEEGRPQHQEQLRQQAHYDAMDNDIVQGAEDNotes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
- Material Safety Data Sheet
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



