CacheBy
Atlas Antibodies Anti-GOLIM4 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-GOLIM4 Antibody

상품 한눈에 보기

인간 GOLIM4 단백질을 인식하는 폴리클로날 항체. IHC 및 ICC 응용에 적합하며 RNA-seq 데이터 기반의 정교한 Orthogonal 검증 제공. Rabbit 유래 IgG로 PrEST 항원 친화 정제. 고글지 막 단백질 연구에 최적.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA001677-100 Anti-GOLIM4 Antibody, golgi integral membrane protein 4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA001677-25 Anti-GOLIM4 Antibody, golgi integral membrane protein 4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-GOLIM4 Antibody

Anti-GOLIM4 Antibody

Target: Golgi integral membrane protein 4 (GOLIM4)
Supplier: Atlas Antibodies


  • IHC (Orthogonal Validation): Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
  • ICC: Suitable for immunocytochemistry applications.

Product Description

Polyclonal antibody against human GOLIM4.


Alternative Gene Names

GIMPC, GOLPH4, GPP130, P138

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Golgi integral membrane protein 4
Target Gene GOLIM4
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse (71%), Rat (70%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using PrEST antigen as affinity ligand

Antigen Sequence

EHLEEEHDPSPEEQDREWKEQHEQREAANLLEGHARAEVYPSAKPMIKFQSPYEEQLEQQRLAVQQVEEAQQLREHQEALHQQRLQGHLLRQQEQQQQQVAREMALQRQAELEEGRPQHQEQLRQQAHYDAMDNDIVQGAED

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.
  • Material Safety Data Sheet

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.