CacheBy
Atlas Antibodies Anti-GOLM1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-GOLM1 Antibody

상품 한눈에 보기

인간 GOLM1 단백질을 인식하는 토끼 폴리클로날 항체. IHC, WB, ICC 등 다양한 응용에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 제공. RNA-seq 기반 직교 검증으로 신뢰성 향상.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA010638-100 Anti-GOLM1 Antibody, golgi membrane protein 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA010638-25 Anti-GOLM1 Antibody, golgi membrane protein 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-GOLM1 Antibody

Anti-GOLM1 Antibody

Target Protein: Golgi membrane protein 1 (GOLM1)

Supplier: Atlas Antibodies


  • IHC (Orthogonal validation: comparison to RNA-seq data in tissues with high and low expression)
  • WB (Western Blot)
  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against human GOLM1.

Alternative Gene Names

bA379P1.3, C9orf155, FLJ23608, GOLPH2, GP73

Open Datasheet


Specifications

항목 내용
Target Protein Golgi membrane protein 1
Target Gene GOLM1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence GKGNVLGNSKSQTPAPSSEVVLDSKRQVEKEETNEIQVVNEEPQRDRLPQEPGREQVVEDRPVGGRGFGGAGELGQTPQVQAALSVSQENPEMEGPERDQLVIPDGQEEEQEAAGEGRNQQKLRGEDDYNMDENEAESE
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000021556 (46%), Rat ENSRNOG00000018400 (45%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Notes Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip
WB Application
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.