Atlas Antibodies Anti-GOLGB1 Antibody

상품 한눈에 보기

Human GOLGB1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 ICC에 적합합니다. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성을 제공합니다. 인간 시료에 검증되었으며, 다양한 종과의 반응성 정보가 포함되어 있습니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA011555-100 Anti-GOLGB1 Antibody, golgin B1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA011555-25 Anti-GOLGB1 Antibody, golgin B1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target Protein: golgin B1
Gene Symbol: GOLGB1
Supplier: Atlas Antibodies

IHC (Immunohistochemistry) — Independent antibody validation
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
ICC (Immunocytochemistry)

Polyclonal antibody against human GOLGB1 (golgin B1).

GCP, GCP372, giantin, GOLIM1

Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

Sequence:

KHDNQTNVTEEGTQSIPGETEEQDSLSMSTRPTCSESVPSAKSANPAVSKDFSSHDEINNYLQQIDQLKERIAGLEEEKQKNKEFSQTLENEKNTLLSQISTKDGELKMLQEEVTKMNLLNQQIQEELS

Verified: Human
Interspecies Identity:
- Rat (ENSRNOG00000030314): 63%
- Mouse (ENSMUSG00000034243): 60%

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol, PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Storage	Gently mix before use. Store according to manufacturer’s recommendation.
Notes	Optimal concentrations and conditions for each application should be determined by the user.