CacheBy
Atlas Antibodies Anti-GOLGB1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-GOLGB1 Antibody

상품 한눈에 보기

Human GOLGB1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 ICC에 적합합니다. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성을 제공합니다. 인간 시료에 검증되었으며, 다양한 종과의 반응성 정보가 포함되어 있습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA011555-100 Anti-GOLGB1 Antibody, golgin B1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA011555-25 Anti-GOLGB1 Antibody, golgin B1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-GOLGB1 Antibody

Anti-GOLGB1 Antibody

Target Protein: golgin B1
Gene Symbol: GOLGB1
Supplier: Atlas Antibodies


  • IHC (Immunohistochemistry) — Independent antibody validation
    Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against human GOLGB1 (golgin B1).


Alternative Gene Names

GCP, GCP372, giantin, GOLIM1

Open Datasheet (PDF)


Antigen Information

Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

Sequence:

KHDNQTNVTEEGTQSIPGETEEQDSLSMSTRPTCSESVPSAKSANPAVSKDFSSHDEINNYLQQIDQLKERIAGLEEEKQKNKEFSQTLENEKNTLLSQISTKDGELKMLQEEVTKMNLLNQQIQEELS

Species Reactivity

  • Verified: Human
  • Interspecies Identity:
    • Rat (ENSRNOG00000030314): 63%
    • Mouse (ENSMUSG00000034243): 60%

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol, PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Storage Gently mix before use. Store according to manufacturer’s recommendation.
Notes Optimal concentrations and conditions for each application should be determined by the user.

Material Safety Data Sheet (MSDS)


제품 이미지

Enhanced Validation
IHC Independent Validation
Independent Validation Tooltip
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.