CacheBy
Atlas Antibodies Anti-GNL2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-GNL2 Antibody

상품 한눈에 보기

인간 GNL2 단백질을 인식하는 고특이적 폴리클로날 항체입니다. IHC, WB, ICC 등 다양한 응용에 적합합니다. 토끼 유래 IgG 형태로 프레스트 항원을 이용해 친화 정제되었습니다. 휴먼 반응성이 검증되어 연구용으로 최적화되었습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA027163-100 Anti-GNL2 Antibody, guanine nucleotide binding protein-like 2 (nucleolar) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA027163-25 Anti-GNL2 Antibody, guanine nucleotide binding protein-like 2 (nucleolar) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-GNL2 Antibody

Anti-GNL2 Antibody

Target: guanine nucleotide binding protein-like 2 (nucleolar)

  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human GNL2.

Alternative Gene Names

  • HUMAUANTIG
  • Ngp-1

Open Datasheet

Target Information

항목 내용
Target Protein guanine nucleotide binding protein-like 2 (nucleolar)
Target Gene GNL2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000028869 (68%), Rat ENSRNOG00000009430 (68%)

Antigen Sequence:

RIPFFVKPPNAEPLVAPQLLPSSSLEVVPEAAQNNPGEEVTETAGEGSESIIKEETEENSHCDANTEMQQILTRVRQNFGKINVVPQFSGDDLVPV

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.