CacheBy
Atlas Antibodies Anti-GNL3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-GNL3 Antibody

상품 한눈에 보기

Human GNL3 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 WB에 적합. PrEST 항원으로 친화 정제됨. 인간에 특이적으로 반응하며, 단백질 발현 검증에 유용. 안정한 보존용 완충액 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA036743-100 Anti-GNL3 Antibody, guanine nucleotide binding protein-like 3 (nucleolar) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA036743-25 Anti-GNL3 Antibody, guanine nucleotide binding protein-like 3 (nucleolar) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-GNL3 Antibody

Anti-GNL3 Antibody

Target: guanine nucleotide binding protein-like 3 (nucleolar)


  • IHC (Independent Antibody Validation): Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
  • WB (Western Blot)

Product Description

Polyclonal Antibody against Human GNL3


Alternative Gene Names

C77032, E2IG3, MGC800, NS, nucleostemin

Open Datasheet


Target Information

항목 내용
Target Protein guanine nucleotide binding protein-like 3 (nucleolar)
Target Gene GNL3
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence KQQQKLDRQKELEKKRKLETNPDIKPSNVEPMEKEFGLCKTENKAKSGKQNSKKLYCQELKKVIEASDVVLE
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000028461 (69%), Mouse ENSMUSG00000042354 (67%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

구성 내용
Buffer Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Independent Validation
Independent Validation Tooltip
Western Blot

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.