Atlas Antibodies Anti-GNL3L Antibody

상품 한눈에 보기

Human GNL3L 단백질을 인식하는 폴리클로날 항체로, WB 및 IHC 응용에 적합합니다. Rabbit 유래 IgG이며, PrEST 항원으로 정제되었습니다. Human, Mouse, Rat 반응성이 검증되어 다양한 종 분석에 활용 가능합니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA036315-100 Anti-GNL3L Antibody, guanine nucleotide binding protein-like 3 (nucleolar)-like 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA036315-25 Anti-GNL3L Antibody, guanine nucleotide binding protein-like 3 (nucleolar)-like 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: guanine nucleotide binding protein-like 3 (nucleolar)-like
Type: Polyclonal Antibody against Human GNL3L

Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.

항목	내용
Target Protein	guanine nucleotide binding protein-like 3 (nucleolar)-like
Target Gene	GNL3L
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	HFLTAVAHRLGKKKKGGLYSQEQAAKAVLADWVSGKISFYIPPPATHTLPTHLSAEIVKEMTEVFDIED

종	Ortholog ID	Sequence Identity
Rat	ENSRNOG00000002509	94%
Mouse	ENSMUSG00000025266	94%

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand