
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-GNL3L Antibody
상품 한눈에 보기
Human GNL3L 단백질을 인식하는 폴리클로날 항체로, WB 및 IHC 응용에 적합합니다. Rabbit 유래 IgG이며, PrEST 항원으로 정제되었습니다. Human, Mouse, Rat 반응성이 검증되어 다양한 종 분석에 활용 가능합니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA036315-100 Anti-GNL3L Antibody, guanine nucleotide binding protein-like 3 (nucleolar)-like 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA036315-25 Anti-GNL3L Antibody, guanine nucleotide binding protein-like 3 (nucleolar)-like 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-GNL3L Antibody
Anti-GNL3L Antibody
Target: guanine nucleotide binding protein-like 3 (nucleolar)-like
Type: Polyclonal Antibody against Human GNL3L
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
Alternative Gene Names
- FLJ10613
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | guanine nucleotide binding protein-like 3 (nucleolar)-like |
| Target Gene | GNL3L |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | HFLTAVAHRLGKKKKGGLYSQEQAAKAVLADWVSGKISFYIPPPATHTLPTHLSAEIVKEMTEVFDIED |
Verified Species Reactivity
- Human
- Mouse
- Rat
Interspecies Information
| 종 | Ortholog ID | Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000002509 | 94% |
| Mouse | ENSMUSG00000025266 | 94% |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- 사용 전 부드럽게 혼합하십시오.
- 각 응용 분야에 대한 최적 조건은 사용자가 결정해야 합니다.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



