Atlas Antibodies Anti-GNL3L Antibody

상품 한눈에 보기

Human GNL3L 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB 실험에 적합. PrEST 항원으로 정제되어 높은 특이성과 재현성을 제공. 인간, 마우스, 랫트에 반응하며 40% 글리세롤 PBS 버퍼에 보존.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA036314-100 Anti-GNL3L Antibody, guanine nucleotide binding protein-like 3 (nucleolar)-like 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA036314-25 Anti-GNL3L Antibody, guanine nucleotide binding protein-like 3 (nucleolar)-like 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: guanine nucleotide binding protein-like 3 (nucleolar)-like
Supplier: Atlas Antibodies

Independent Validation:
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.

Polyclonal antibody against Human GNL3L.

항목	내용
Target Protein	guanine nucleotide binding protein-like 3 (nucleolar)-like
Target Gene	GNL3L
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human, Mouse, Rat
Interspecies Identity	Rat ENSRNOG00000002509 (94%), Mouse ENSMUSG00000025266 (94%)

Antigen Sequence:

HFLTAVAHRLGKKKKGGLYSQEQAAKAVLADWVSGKISFYIPPPATHTLPTHLSAEIVKEMTEVFDIED

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
MSDS	Material Safety Data Sheet