CacheBy
Atlas Antibodies Anti-GNL3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-GNL3 Antibody

상품 한눈에 보기

Human GNL3 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB 실험에 적합합니다. PrEST 항원으로 친화 정제되었으며, 높은 특이성과 재현성을 제공합니다. 인체 GNL3 단백질 발현 분석에 유용합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA036742-100 Anti-GNL3 Antibody, guanine nucleotide binding protein-like 3 (nucleolar) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA036742-25 Anti-GNL3 Antibody, guanine nucleotide binding protein-like 3 (nucleolar) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-GNL3 Antibody

Anti-GNL3 Antibody

Target: guanine nucleotide binding protein-like 3 (nucleolar)
Supplier: Atlas Antibodies


  • IHC (Independent Antibody Validation): 단백질 발현을 서로 다른 에피토프를 인식하는 독립 항체 간 비교를 통해 검증
  • WB (Western Blot)

Product Description

Polyclonal antibody against Human GNL3.


Alternative Gene Names

C77032, E2IG3, MGC800, NS, nucleostemin


Target Information

항목 내용
Target Protein guanine nucleotide binding protein-like 3 (nucleolar)
Target Gene GNL3
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence KQQQKLDRQKELEKKRKLETNPDIKPSNVEPMEKEFGLCKTENKAKSGKQNSKKLYCQELKKVIEASDVVLE
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000028461 (69%), Mouse ENSMUSG00000042354 (67%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용 분야에 최적의 조건은 사용자가 직접 결정해야 합니다.

Reference

Open Datasheet (PDF)


제품 이미지

Enhanced Validation
IHC Independent
Independent Validation Tooltip
WB

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.