CacheBy
Atlas Antibodies Anti-GNAO1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-GNAO1 Antibody

상품 한눈에 보기

Human GNAO1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 Western Blot 검증 완료. Orthogonal validation으로 RNA-seq 데이터와 비교 검증됨. PrEST 항원을 이용해 친화 정제된 고품질 항체.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA040878-100 Anti-GNAO1 Antibody, guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA040878-25 Anti-GNAO1 Antibody, guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-GNAO1 Antibody

Anti-GNAO1 Antibody

Target: guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O
Supplier: Atlas Antibodies


  • IHC (Immunohistochemistry) – Orthogonal validation of protein expression using comparison to RNA-seq data in high and low expression tissues.
  • WB (Western Blot)

Product Description

Polyclonal antibody against Human GNAO1.


Alternative Gene Names

  • G-ALPHA-o

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O
Target Gene GNAO1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence IQSLAAIVRAMDTLGIEYGDKERKADAKMVCDVVSRMEDTEPFSAELLSAMMRLWGDSGIQECF
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000019482 (97%), Mouse ENSMUSG00000031748 (95%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용 분야에 대한 최적의 농도 및 조건은 사용자가 직접 결정해야 합니다.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip
WB Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.