CacheBy
Atlas Antibodies Anti-GNA13 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-GNA13 Antibody

상품 한눈에 보기

Human GNA13 단백질을 타깃하는 폴리클로날 항체로, IHC 및 ICC 응용에 적합함. Rabbit 호스트에서 생산된 IgG 항체이며, Affinity purification 방식으로 정제됨. GNA13 유전자 및 단백질 연구에 활용 가능.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA010087-100 Anti-GNA13 Antibody, guanine nucleotide binding protein (G protein), alpha 13 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA010087-25 Anti-GNA13 Antibody, guanine nucleotide binding protein (G protein), alpha 13 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-GNA13 Antibody

Anti-GNA13 Antibody

Target: guanine nucleotide binding protein (G protein), alpha 13
Type: Polyclonal Antibody against Human GNA13

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody targeting human GNA13 protein.

Alternative Gene Names

  • G13
  • MGC46138

Open Datasheet

Target Information

항목 내용
Target Protein guanine nucleotide binding protein (G protein), alpha 13
Target Gene GNA13
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000036745 (95%), Mouse ENSMUSG00000020611 (95%)

Antigen Sequence:
HGQDFDQRAREEFRPTIYSNVIKGMRVLVDAREKLHIPWGDNSNQQHGDKMMSFDTRAPMAAQGMVETRVFLQYLPAIRALWADSGIQNAYDRRREFQLGES

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.