
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-GNA13 Antibody
상품 한눈에 보기
Human GNA13 단백질을 타깃하는 폴리클로날 항체로, IHC 및 ICC 응용에 적합함. Rabbit 호스트에서 생산된 IgG 항체이며, Affinity purification 방식으로 정제됨. GNA13 유전자 및 단백질 연구에 활용 가능.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA010087-100 Anti-GNA13 Antibody, guanine nucleotide binding protein (G protein), alpha 13 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA010087-25 Anti-GNA13 Antibody, guanine nucleotide binding protein (G protein), alpha 13 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-GNA13 Antibody
Anti-GNA13 Antibody
Target: guanine nucleotide binding protein (G protein), alpha 13
Type: Polyclonal Antibody against Human GNA13
Recommended Applications
- Immunohistochemistry (IHC)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody targeting human GNA13 protein.
Alternative Gene Names
- G13
- MGC46138
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | guanine nucleotide binding protein (G protein), alpha 13 |
| Target Gene | GNA13 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000036745 (95%), Mouse ENSMUSG00000020611 (95%) |
Antigen Sequence:
HGQDFDQRAREEFRPTIYSNVIKGMRVLVDAREKLHIPWGDNSNQQHGDKMMSFDTRAPMAAQGMVETRVFLQYLPAIRALWADSGIQNAYDRRREFQLGES
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



