CacheBy
Atlas Antibodies Anti-GNAL Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-GNAL Antibody

상품 한눈에 보기

Human GNAL 단백질을 인식하는 폴리클로날 항체로, 토끼에서 생산된 IgG 형식입니다. IHC 등 다양한 응용에 적합하며, PrEST 항원으로 특이적 정제되었습니다. 인간, 마우스, 랫트에 모두 반응성이 확인되었습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA051160-100 Anti-GNAL Antibody, G protein subunit alpha L 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA051160-25 Anti-GNAL Antibody, G protein subunit alpha L 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-GNAL Antibody

Anti-GNAL Antibody

Target Information

  • Target Protein: G protein subunit alpha L
  • Target Gene: GNAL
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
    NQFRSDYIKSIAPITDFEYSQEFFDHVKKLWDDEGVKACFER

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse (ENSMUSG00000024524): 100%
  • Rat (ENSRNOG00000010440): 100%

Product Description

Polyclonal Antibody against Human GNAL

Open Datasheet (PDF)

면역조직화학(IHC)에 권장됨

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet (Sodium Azide)

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 최적의 농도 및 조건은 사용자가 직접 실험을 통해 결정해야 합니다.

제품 이미지

Recommended Application - IHC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.