CacheBy
Atlas Antibodies Anti-GLTP Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-GLTP Antibody

상품 한눈에 보기

인간 GLTP를 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC에 적합합니다. siRNA 노크다운으로 유전적 검증 완료. PrEST 항원을 이용한 친화정제 방식으로 높은 특이성과 재현성을 제공합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA056461-100 Anti-GLTP Antibody, glycolipid transfer protein 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA056461-25 Anti-GLTP Antibody, glycolipid transfer protein 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-GLTP Antibody

Anti-GLTP Antibody

Target: Glycolipid Transfer Protein (GLTP)
Supplier: Atlas Antibodies

  • Immunohistochemistry (IHC)
  • Western Blot (WB) – Genetic validation by siRNA knockdown
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human GLTP.

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein Glycolipid transfer protein
Target Gene GLTP
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence ALLAEHLLKPLPADKQIETGPFLEAVSHLPPFFDCLGSPVFTPIKADISG
Verified Species Reactivity Human
Interspecies Homology Rat ENSRNOG00000001192 (96%), Mouse ENSMUSG00000011884 (96%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Application
Genetic Validation
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.