CacheBy
Atlas Antibodies Anti-GLTSCR1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-GLTSCR1 Antibody

상품 한눈에 보기

인간 GLTSCR1 단백질을 인식하는 폴리클로날 항체로, IHC 및 ICC에 적합합니다. 토끼 호스트에서 생산되었으며, PrEST 항원으로 친화 정제되었습니다. 인간에 대한 반응성이 검증되었으며, 높은 종간 항원 서열 동일성을 보입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA056211-100 Anti-GLTSCR1 Antibody, glioma tumor suppressor candidate region gene 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA056211-25 Anti-GLTSCR1 Antibody, glioma tumor suppressor candidate region gene 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-GLTSCR1 Antibody

Anti-GLTSCR1 Antibody

Target Information

  • Target Protein: glioma tumor suppressor candidate region gene 1
  • Target Gene: GLTSCR1
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
    ASSLDADEDGPMPSRNRPPIKTYEARSRIGLKLKIKQEAGLSKVVHNTALDPVHQPPPPPATLKVA

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse ENSMUSG00000070808 (89%)
  • Rat ENSRNOG00000011262 (89%)

Product Description

Polyclonal Antibody against Human GLTSCR1
Open Datasheet

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand
  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC Application
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.