AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-GLTP Antibody
상품 한눈에 보기
Human GLTP를 인식하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. siRNA knockdown을 통한 유전적 검증 완료. Rabbit 유래 IgG 항체이며, PrEST 항원으로 정제된 고품질 제품입니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA065503-100 Anti-GLTP Antibody, glycolipid transfer protein 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA065503-25 Anti-GLTP Antibody, glycolipid transfer protein 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-GLTP Antibody
Anti-GLTP Antibody
Target: Glycolipid Transfer Protein (GLTP)
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB) — Genetic validation by siRNA knockdown
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against Human GLTP.
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Glycolipid transfer protein |
| Target Gene | GLTP |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000011884 (96%), Rat ENSRNOG00000001192 (96%) |
Antigen Sequence:
ALLAEHLLKPLPADKQIETGPFLEAVSHLPPFFDCLGSPVFTPIKADISG
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Material Safety Data Sheet (MSDS)
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.