
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-GGA3 Antibody
상품 한눈에 보기
Human GGA3 단백질을 인식하는 Rabbit Polyclonal 항체로, 골지체 관련 단백질 연구에 적합합니다. Affinity purification 방식으로 정제되었으며, IHC 등 다양한 응용에 사용 가능합니다. Human 종에 대해 검증되었습니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA022945-100 Anti-GGA3 Antibody, golgi-associated, gamma adaptin ear containing, ARF binding protein 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA022945-25 Anti-GGA3 Antibody, golgi-associated, gamma adaptin ear containing, ARF binding protein 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-GGA3 Antibody
Anti-GGA3 Antibody
Target Protein: golgi-associated, gamma adaptin ear containing, ARF binding protein 3
Product Type: Polyclonal Antibody against Human GGA3
Recommended Applications
면역조직화학(IHC) 등 다양한 연구 응용에 사용 가능합니다.
Product Description
이 항체는 Human GGA3 단백질을 인식하는 Rabbit Polyclonal Antibody입니다.
골지체 관련 단백질 연구에 적합하며, PrEST 항원을 이용한 Affinity purification으로 정제되었습니다.
Alternative Gene Names
- KIAA0154
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | golgi-associated, gamma adaptin ear containing, ARF binding protein 3 |
| Target Gene | GGA3 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | LDFFSPRPGTAACGASDAPLLQPSAPSSSSSQAPLPPPFPAPVVPASVPAPSAGSSLFSTGVAPALAPKVEPAVPGHH |
Verified Species Reactivity
- Human
Interspecies Information
| 종 | Ortholog ID | 항원 서열 유사도 |
|---|---|---|
| Mouse | ENSMUSG00000020740 | 63% |
| Rat | ENSRNOG00000027057 | 58% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 구성 성분 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- 사용 전 부드럽게 혼합하십시오.
- 각 응용 분야에 맞는 최적의 농도와 조건은 사용자가 결정해야 합니다.
Reference
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



