CacheBy
Atlas Antibodies Anti-GGA2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-GGA2 Antibody

상품 한눈에 보기

Human GGA2 단백질을 인식하는 Rabbit Polyclonal 항체로, WB 및 ICC에 적합합니다. PrEST 항원으로 Affinity 정제되었으며, 높은 특이성과 재현성을 제공합니다. GGA2 관련 세포 내 단백질 연구에 활용됩니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA063634-100 Anti-GGA2 Antibody, golgi-associated, gamma adaptin ear containing, ARF binding protein 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA063634-25 Anti-GGA2 Antibody, golgi-associated, gamma adaptin ear containing, ARF binding protein 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-GGA2 Antibody

Anti-GGA2 Antibody

Target: golgi-associated, gamma adaptin ear containing, ARF binding protein 2
Supplier: Atlas Antibodies


  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal Antibody against Human GGA2


Alternative Gene Names

  • KIAA1080
  • VEAR

Open Datasheet


Target Information

항목 내용
Target Protein golgi-associated, gamma adaptin ear containing, ARF binding protein 2
Target Gene GGA2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat (64%), Mouse (60%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen
Notes Gently mix before use. Optimal concentrations and conditions should be determined by the user.

Antigen Sequence

ANDLLTQGVLLYKQVMEGRVTFGNRVTSSLGDIPVSRVFQNPAGCMKTCPLIDLEVDNGPAQMGTVVPSLLHQDLAALGISDAPV

Safety Information

Material Safety Data Sheet (Sodium Azide)


제품 이미지

WB Application
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.