
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-TRNAU1AP Antibody
상품 한눈에 보기
Human TRNAU1AP 단백질을 인식하는 토끼 유래 폴리클로날 항체. ICC 등 다양한 응용에 적합하며, PrEST 항원을 이용해 친화 정제됨. 인간, 랫, 마우스에서 높은 반응성 확인. 글리세롤/PBS 완충액에 보존.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA032068-100 Anti-TRNAU1AP Antibody, tRNA selenocysteine 1 associated protein 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA032068-25 Anti-TRNAU1AP Antibody, tRNA selenocysteine 1 associated protein 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-TRNAU1AP Antibody
Anti-TRNAU1AP Antibody
Target Information
- Target Protein: tRNA selenocysteine 1 associated protein 1
- Target Gene: TRNAU1AP
- Alternative Gene Names: FLJ20503, SECP43, TRSPAP1
Product Description
Polyclonal antibody against Human TRNAU1AP.
Recommended for immunocytochemistry (ICC) and related applications.
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
- Antigen Sequence:
WMGDLEPYMDENFISRAFATMGETVMSVKIIRNRLTGIPAGYCFVEFADLATAEKCLHKINGKPLPGATP
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Rat ENSRNOG00000055344 (100%)
- Mouse ENSMUSG00000028898 (100%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide as preservative |
| Storage | Gently mix before use. Optimal concentrations and conditions should be determined by the user. |
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



