CacheBy
Atlas Antibodies Anti-TRMT61B Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TRMT61B Antibody

상품 한눈에 보기

인간 TRMT61B 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB 검증에 적합합니다. 토끼 유래 IgG 형태이며, PrEST 항원을 이용해 친화 정제되었습니다. 40% 글리세롤 PBS 버퍼에 보존제로 아지드가 포함되어 있습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA026751-100 Anti-TRMT61B Antibody, tRNA methyltransferase 61 homolog B (S. cerevisiae) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA026751-25 Anti-TRMT61B Antibody, tRNA methyltransferase 61 homolog B (S. cerevisiae) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TRMT61B Antibody

Anti-TRMT61B Antibody

tRNA methyltransferase 61 homolog B (S. cerevisiae)

  • IHC (Independent Validation): Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
  • WB (Recombinant Expression Validation): Recombinant expression validation in WB using target protein overexpression.

Product Description

Polyclonal Antibody against Human TRMT61B

Alternative Gene Names

  • FLJ20628

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein tRNA methyltransferase 61 homolog B (S. cerevisiae)
Target Gene TRMT61B
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence KRGTAITFPKDINMILSMMDINPGDTVLEAGSGSGGMSLFLSKAVGSQGRVISFEVRKDHHDLAKKNYKHWRDSWKLSHVEEWPDNVDFIHKDISGATEDIKSLTFDAVALDMLN
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000050860 (24%), Mouse ENSMUSG00000035916 (22%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Material Safety Data Sheet (MSDS)

제품 이미지

Enhanced Validation
IHC Independent Validation
WB Recombinant Expression Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.