
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-TRMU Antibody
상품 한눈에 보기
Human TRMU 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산된 IgG 형식입니다. Affinity purification으로 높은 특이성과 재현성을 제공합니다. IHC 등 다양한 응용에 적합하며, 40% glycerol 기반의 안정한 보관 용액을 포함합니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA043300-100 Anti-TRMU Antibody, tRNA 5-methylaminomethyl-2-thiouridylate methyltransferase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA043300-25 Anti-TRMU Antibody, tRNA 5-methylaminomethyl-2-thiouridylate methyltransferase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-TRMU Antibody
Anti-TRMU Antibody
tRNA 5-methylaminomethyl-2-thiouridylate methyltransferase
Recommended Applications
tRNA 5-methylaminomethyl-2-thiouridylate methyltransferase 단백질 검출용 항체로, 면역조직화학(IHC) 등 다양한 연구 응용에 적합합니다.
Product Description
Polyclonal Antibody against Human TRMU
Alternative Gene Names
FLJ10140, MTO2, TRMT
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | tRNA 5-methylaminomethyl-2-thiouridylate methyltransferase |
| Target Gene | TRMU |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
Sequence:
EDNKVLGTHKGWFLYTLGQRANIGGLREPWYVVEKDSVKGDVFVAPRTDHPALYRDLLRTSRVHWIAEEPPAALVRDKMMECHFRFRHQMALVPCVLTLNQDGTVWVTAVQAVRALATGQFAVFYKGDECLGS
Verified Species Reactivity
Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
| Species | Gene ID | Identity |
|---|---|---|
| Mouse | ENSMUSG00000022386 | 91% |
| Rat | ENSRNOG00000016465 | 90% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- 사용 전 부드럽게 혼합하십시오.
- 최적의 농도와 조건은 사용자가 실험에 맞게 결정해야 합니다.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



