CacheBy
Atlas Antibodies Anti-TRMU Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TRMU Antibody

상품 한눈에 보기

Human TRMU 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산된 IgG 형식입니다. Affinity purification으로 높은 특이성과 재현성을 제공합니다. IHC 등 다양한 응용에 적합하며, 40% glycerol 기반의 안정한 보관 용액을 포함합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA043300-100 Anti-TRMU Antibody, tRNA 5-methylaminomethyl-2-thiouridylate methyltransferase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA043300-25 Anti-TRMU Antibody, tRNA 5-methylaminomethyl-2-thiouridylate methyltransferase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TRMU Antibody

Anti-TRMU Antibody

tRNA 5-methylaminomethyl-2-thiouridylate methyltransferase


tRNA 5-methylaminomethyl-2-thiouridylate methyltransferase 단백질 검출용 항체로, 면역조직화학(IHC) 등 다양한 연구 응용에 적합합니다.


Product Description

Polyclonal Antibody against Human TRMU


Alternative Gene Names

FLJ10140, MTO2, TRMT

Open Datasheet


Target Information

항목 내용
Target Protein tRNA 5-methylaminomethyl-2-thiouridylate methyltransferase
Target Gene TRMU
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

Sequence:
EDNKVLGTHKGWFLYTLGQRANIGGLREPWYVVEKDSVKGDVFVAPRTDHPALYRDLLRTSRVHWIAEEPPAALVRDKMMECHFRFRHQMALVPCVLTLNQDGTVWVTAVQAVRALATGQFAVFYKGDECLGS


Verified Species Reactivity

Human


Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Identity
Mouse ENSMUSG00000022386 91%
Rat ENSRNOG00000016465 90%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 최적의 농도와 조건은 사용자가 실험에 맞게 결정해야 합니다.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.