CacheBy
Atlas Antibodies Anti-TRMT6 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TRMT6 Antibody

상품 한눈에 보기

Human TRMT6 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC 실험에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 종간 반응 특이성을 보입니다. 40% 글리세롤 PBS 버퍼에 보존되어 안정적입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA050408-100 Anti-TRMT6 Antibody, tRNA methyltransferase 6 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA050408-25 Anti-TRMT6 Antibody, tRNA methyltransferase 6 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TRMT6 Antibody

Anti-TRMT6 Antibody

tRNA methyltransferase 6 homolog (S. cerevisiae)

  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human TRMT6.

Alternative Gene Names

CGI-09, GCD10, Gcd10p, MGC5029

Open Datasheet

Target Information

항목 내용
Target Protein tRNA methyltransferase 6 homolog (S. cerevisiae)
Target Gene TRMT6
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
KMIVMETCAGLVLGAMMERMGGFGSIIQLYPGGGPVRAATACFGFPKSFLSGLYEFPLNKVDSLLHGTFSAKMLSSEPKDSALVEESNGTLE
Verified Species Reactivity Human
Interspecies Identity Mouse (91%, ENSMUSG00000037376), Rat (89%, ENSRNOG00000021270)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.