Atlas Antibodies Anti-TRMT61A Antibody

상품 한눈에 보기

Human TRMT61A 단백질을 인식하는 토끼 폴리클로날 항체로, tRNA methyltransferase 61A 연구용에 적합. PrEST 항원을 이용해 친화 정제됨. Human에 반응하며, Rat 및 Mouse와 높은 서열 유사성 보유. ICC 등 다양한 응용 가능.

카탈로그번호: HPA024269-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA024269-100 Anti-TRMT61A Antibody, tRNA methyltransferase 61A 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA024269-25 Anti-TRMT61A Antibody, tRNA methyltransferase 61A 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-TRMT61A Antibody

Anti-TRMT61A Antibody

Target Information

Target Protein: tRNA methyltransferase 61A
Target Gene: TRMT61A
Alternative Gene Names: C14orf172, FLJ40452, GCD14, Gcd14p, hTRM61

Product Description

Polyclonal antibody against Human TRMT61A.

Applications

Recommended for use in immunocytochemistry (ICC) and related assays.

Antigen Information

Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence:
GSGSVSHAIIRTIAPTGHLHTVEFHQQRAEKAREEFQEHRVGRWVTVRTQDVCRSGFGVSHVADAVFPDIPSPWEAVGHAWDALKVEGGRFCSFSPCIEQVQRTCQALAARGFSELSTLEVLPQVYNVRTVSLPPPDLGTGTDGPA

Species Reactivity

Verified: Human
Ortholog Identity:
- Rat ENSRNOG00000011398 (88%)
- Mouse ENSMUSG00000060950 (86%)

Antibody Properties

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Storage Notes	Gently mix before use. Optimal concentrations and conditions should be determined by the user.