CacheBy
Atlas Antibodies Anti-TRMT61A Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TRMT61A Antibody

상품 한눈에 보기

Human TRMT61A 단백질을 인식하는 토끼 폴리클로날 항체로, tRNA methyltransferase 61A 연구용에 적합. PrEST 항원을 이용해 친화 정제됨. Human에 반응하며, Rat 및 Mouse와 높은 서열 유사성 보유. ICC 등 다양한 응용 가능.

카탈로그번호
HPA024269-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA024269-100 Anti-TRMT61A Antibody, tRNA methyltransferase 61A 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA024269-25 Anti-TRMT61A Antibody, tRNA methyltransferase 61A 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TRMT61A Antibody

Anti-TRMT61A Antibody

Target Information

  • Target Protein: tRNA methyltransferase 61A
  • Target Gene: TRMT61A
  • Alternative Gene Names: C14orf172, FLJ40452, GCD14, Gcd14p, hTRM61

Product Description

Polyclonal antibody against Human TRMT61A.

Applications

Recommended for use in immunocytochemistry (ICC) and related assays.

Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Sequence:
    GSGSVSHAIIRTIAPTGHLHTVEFHQQRAEKAREEFQEHRVGRWVTVRTQDVCRSGFGVSHVADAVFPDIPSPWEAVGHAWDALKVEGGRFCSFSPCIEQVQRTCQALAARGFSELSTLEVLPQVYNVRTVSLPPPDLGTGTDGPA

Species Reactivity

  • Verified: Human
  • Ortholog Identity:
    • Rat ENSRNOG00000011398 (88%)
    • Mouse ENSMUSG00000060950 (86%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Storage Notes Gently mix before use. Optimal concentrations and conditions should be determined by the user.

Material Safety Data Sheet (MSDS)
Open Datasheet (PDF)

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.