CacheBy
Atlas Antibodies Anti-TRMT61B Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TRMT61B Antibody

상품 한눈에 보기

Human TRMT61B 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 Western blot에 적합. 독립적 항체 검증 및 재조합 발현 검증 완료. Affinity purification 방식으로 높은 특이성과 재현성 제공. 40% glycerol 기반 안정화 버퍼 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA026747-100 Anti-TRMT61B Antibody, tRNA methyltransferase 61 homolog B (S. cerevisiae) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA026747-25 Anti-TRMT61B Antibody, tRNA methyltransferase 61 homolog B (S. cerevisiae) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TRMT61B Antibody

Anti-TRMT61B Antibody

tRNA methyltransferase 61 homolog B (S. cerevisiae)


  • IHC (Independent Antibody Validation): Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
  • WB (Recombinant Expression Validation): Recombinant expression validation in WB using target protein overexpression.

Product Description

Polyclonal Antibody against Human TRMT61B


Alternative Gene Names

  • FLJ20628

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein tRNA methyltransferase 61 homolog B (S. cerevisiae)
Target Gene TRMT61B
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000050860 (24%), Mouse ENSMUSG00000035916 (22%)

Antigen Sequence:

KRGTAITFPKDINMILSMMDINPGDTVLEAGSGSGGMSLFLSKAVGSQGRVISFEVRKDHHDLAKKNYKHWRDSWKLSHVEEWPDNVDFIHKDISGATEDIKSLTFDAVALDMLN

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

구성 성분 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Independent Validation
WB Recombinant Expression Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.