CacheBy
Atlas Antibodies Anti-TRIP11 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TRIP11 Antibody

상품 한눈에 보기

Human TRIP11 단백질을 인식하는 폴리클로날 항체로, IHC 및 ICC 응용에 적합. Rabbit에서 생산된 IgG 형 항체이며, PrEST 항원을 이용한 친화 정제 제품. Human에 대한 반응성이 검증됨. TRIP11 관련 연구에 유용.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA070684-100 Anti-TRIP11 Antibody, thyroid hormone receptor interactor 11 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA070684-25 Anti-TRIP11 Antibody, thyroid hormone receptor interactor 11 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TRIP11 Antibody

Anti-TRIP11 Antibody

Target Protein: Thyroid hormone receptor interactor 11
Supplier: Atlas Antibodies

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human TRIP11.

Alternative Gene Names

CEV14, GMAP-210, Trip230

Open Datasheet

Antigen Information

  • Antigen Sequence Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Sequence:
    QSLGQVGGSLASLTGQISNFTKDMLMEGTEEVEAELPDSRTKEIEAIHAILRSENERLKKLCTDLEEKHEASEIQIKQQSTSYRNQLQQKEVEISHLKARQIALQDQLLKLQSAAQSVPSGAGVPATTASSSFAY

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000021188 77%
Rat ENSRNOG00000005292 77%

Antibody Properties

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative (Material Safety Data Sheet)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.