
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-TRIP10 Antibody
상품 한눈에 보기
Human TRIP10 단백질을 인식하는 Rabbit Polyclonal 항체로, CIP4/HSTP/STOT/STP 대체 유전자명과 관련. Affinity purification 방식으로 정제되었으며, ICC 등 다양한 응용에 적합. 40% glycerol 및 PBS buffer로 안정화된 고품질 항체.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA072625-100 Anti-TRIP10 Antibody, thyroid hormone receptor interactor 10 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA072625-25 Anti-TRIP10 Antibody, thyroid hormone receptor interactor 10 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-TRIP10 Antibody
Anti-TRIP10 Antibody
Target: Thyroid hormone receptor interactor 10 (TRIP10)
Supplier: Atlas Antibodies
Product Description
Polyclonal antibody against human TRIP10, also known as thyroid hormone receptor interactor 10.
Alternative Gene Names
CIP4, HSTP, STOT, STP
Recommended Applications
- Immunocytochemistry (ICC)
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Thyroid hormone receptor interactor 10 |
| Target Gene | TRIP10 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | LQRFNRDQAHFYFSQMPQIFDKLQDMDERRATRLGAGYGLLSEAELEVVPIIA |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse (96%), Rat (89%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2)
0.02% sodium azide added as preservative
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Additional Resources
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



