Atlas Antibodies Anti-TRIP13 Antibody

상품 한눈에 보기

Human TRIP13 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC에 적합. Orthogonal 및 recombinant expression 검증 완료. Rabbit 유래 IgG 형태이며, PrEST 항원으로 정제됨. Human에 대한 반응성 확인됨.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA005727-100 Anti-TRIP13 Antibody, thyroid hormone receptor interactor 13 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA005727-25 Anti-TRIP13 Antibody, thyroid hormone receptor interactor 13 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: Thyroid hormone receptor interactor 13 (TRIP13)
Supplier: Atlas Antibodies

IHC (Orthogonal validation): Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
WB (Recombinant expression validation): Recombinant expression validation in WB using target protein overexpression.
ICC: Suitable for immunocytochemistry applications.

Polyclonal antibody against Human TRIP13

항목	내용
Target Protein	Thyroid hormone receptor interactor 13
Target Gene	TRIP13
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	STAKKEDINLSVRKLLNRHNIVFGDYTWTEFDEPFLTRNVQSVSIIDTELKVKDSQPIDLSACTVALHIFQLNEDGPSSENLEEETENIIAANHWVLPAAEFHGLWDSLVYDVEVKSH
Verified Species Reactivity	Human
Interspecies Identity	Rat ENSRNOG00000015810 (89%), Mouse ENSMUSG00000021569 (88%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand