Atlas Antibodies Anti-TREH Antibody

상품 한눈에 보기

인체 TREH 단백질을 표적으로 하는 고품질 폴리클로날 항체. IHC 및 RNA-seq 비교를 통한 정교한 Orthogonal 검증 제공. Rabbit 유래 IgG, PrEST 항원 기반 친화 정제. Human에 대한 반응성 검증 완료.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA039913-100 Anti-TREH Antibody, trehalase (brush-border membrane glycoprotein) 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA039913-25 Anti-TREH Antibody, trehalase (brush-border membrane glycoprotein) 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: trehalase (brush-border membrane glycoprotein)
Supplier: Atlas Antibodies

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Polyclonal Antibody against Human TREH

MGC129621, TRE, TREA

항목	내용
Target Protein	trehalase (brush-border membrane glycoprotein)
Target Gene	TREH
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Information	Mouse ENSMUSG00000032098 (74%), Rat ENSRNOG00000052010 (73%)

Antigen Sequence:
LYQDDKQFVDMPLSIAPEQVLQTFTELSRDHNHSIPREQLQAFVHEHFQAKGQELQPWTPADWKDSPQFLQKISDAKLRAWAGQLHQLWKKLGKK

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand