
원본
Atlas Antibodies Anti-TPRX1 Antibody
상품 한눈에 보기
Human TPRX1 단백질을 인식하는 토끼 유래 폴리클로날 항체. IHC 등 다양한 응용에 적합하며, PrEST 항원을 이용해 친화 정제됨. 인간에 대한 반응성이 검증되었으며, 보존제로 sodium azide가 포함됨.
- 카탈로그번호
- HPA044922-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA044922-100 Anti-TPRX1 Antibody, tetra-peptide repeat homeobox 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA044922-25 Anti-TPRX1 Antibody, tetra-peptide repeat homeobox 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-TPRX1 Antibody
Anti-TPRX1 Antibody
Target Protein: tetra-peptide repeat homeobox 1 (TPRX1)
Supplier: Atlas Antibodies
Product Description
Polyclonal antibody against human TPRX1, generated in rabbit and affinity purified using PrEST antigen.
Recommended Applications
- Immunohistochemistry (IHC)
Alternative Gene Names
- FLJ40321
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | tetra-peptide repeat homeobox 1 |
| Target Gene | TPRX1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | AKLARERRLQQQPQRVPGQRGRGARAAPLVPAASASAPQRGPSGILPAAEPTICSLHQAWGGPGCRAQKGIPAALSPGPGPIPAPIPGPAQIPGPLPGSIPGPIPGPAQIPSP |
Verified Species Reactivity
- Human
Interspecies Information
| Species | Ortholog ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000096953 | 37% |
| Rat | ENSRNOG00000019723 | 36% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Additional Information
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



