CacheBy
Atlas Antibodies Anti-TPRX1 Antibody
원본

Atlas Antibodies Anti-TPRX1 Antibody

상품 한눈에 보기

Human TPRX1 단백질을 인식하는 토끼 유래 폴리클로날 항체. IHC 등 다양한 응용에 적합하며, PrEST 항원을 이용해 친화 정제됨. 인간에 대한 반응성이 검증되었으며, 보존제로 sodium azide가 포함됨.

카탈로그번호
HPA044922-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA044922-100 Anti-TPRX1 Antibody, tetra-peptide repeat homeobox 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA044922-25 Anti-TPRX1 Antibody, tetra-peptide repeat homeobox 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TPRX1 Antibody

Anti-TPRX1 Antibody

Target Protein: tetra-peptide repeat homeobox 1 (TPRX1)
Supplier: Atlas Antibodies


Product Description

Polyclonal antibody against human TPRX1, generated in rabbit and affinity purified using PrEST antigen.


  • Immunohistochemistry (IHC)


Alternative Gene Names

  • FLJ40321

Target Information

항목 내용
Target Protein tetra-peptide repeat homeobox 1
Target Gene TPRX1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence AKLARERRLQQQPQRVPGQRGRGARAAPLVPAASASAPQRGPSGILPAAEPTICSLHQAWGGPGCRAQKGIPAALSPGPGPIPAPIPGPAQIPGPLPGSIPGPIPGPAQIPSP

Verified Species Reactivity

  • Human

Interspecies Information

Species Ortholog ID Sequence Identity
Mouse ENSMUSG00000096953 37%
Rat ENSRNOG00000019723 36%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Information

Open Datasheet (PDF)


제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.