Atlas Antibodies Anti-TPSG1 Antibody

상품 한눈에 보기

Human TPSG1 단백질을 인식하는 폴리클로날 항체로, IHC 및 오쏘고날 검증에 적합합니다. Rabbit 유래 IgG 항체이며 PrEST 항원으로 정제되었습니다. 고순도, 인체 반응성 검증 완료. 연구용으로 tryptase gamma 1 단백질 분석에 활용 가능.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

ADBIX 2026 전시회10/28~30 코엑스 · 사전등록 안내자세히보기

Atlas Antibodies HPA060458-100 Anti-TPSG1 Antibody, tryptase gamma 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA060458-25 Anti-TPSG1 Antibody, tryptase gamma 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-TPSG1 Antibody

Anti-TPSG1 Antibody

Target: tryptase gamma 1
Supplier: Atlas Antibodies

Recommended Applications

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal antibody against human TPSG1.

Alternative Gene Names

PRSS31, TMT

Open Datasheet (PDF)

Antigen Information

Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
PYSLREVKVSVVDTETCRRDYPGPGGSILQPDMLCAR

Species Reactivity

Verified Species: Human

Interspecies Information:
| Species | Ortholog ID | Sequence Identity |
|----------|--------------|------------------|
| Mouse | ENSMUSG00000033200 | 65% |
| Rat | ENSRNOG00000018701 | 59% |

Antibody Properties

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)