CacheBy
Atlas Antibodies Anti-TPSG1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TPSG1 Antibody

상품 한눈에 보기

Human TPSG1 단백질을 인식하는 폴리클로날 항체로, IHC 및 오쏘고날 검증에 적합합니다. Rabbit 유래 IgG 항체이며 PrEST 항원으로 정제되었습니다. 고순도, 인체 반응성 검증 완료. 연구용으로 tryptase gamma 1 단백질 분석에 활용 가능.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA060458-100 Anti-TPSG1 Antibody, tryptase gamma 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA060458-25 Anti-TPSG1 Antibody, tryptase gamma 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TPSG1 Antibody

Anti-TPSG1 Antibody

Target: tryptase gamma 1
Supplier: Atlas Antibodies


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal antibody against human TPSG1.


Alternative Gene Names

PRSS31, TMT

Open Datasheet (PDF)


Antigen Information

  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
    PYSLREVKVSVVDTETCRRDYPGPGGSILQPDMLCAR

Species Reactivity

Verified Species: Human

Interspecies Information:
| Species | Ortholog ID | Sequence Identity |
|----------|--------------|------------------|
| Mouse | ENSMUSG00000033200 | 65% |
| Rat | ENSRNOG00000018701 | 59% |


Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.