
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-TPSB2 Antibody
상품 한눈에 보기
Human TPSB2를 인식하는 폴리클로날 항체로, IHC 및 WB에 적합합니다. Rabbit에서 생산된 IgG 형식이며, PrEST 항원을 이용해 친화 정제되었습니다. 40% glycerol 기반 PBS 버퍼에 보존제로 sodium azide가 포함되어 있습니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA049153-100 Anti-TPSB2 Antibody, tryptase beta 2 (gene/pseudogene) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA049153-25 Anti-TPSB2 Antibody, tryptase beta 2 (gene/pseudogene) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-TPSB2 Antibody
Anti-TPSB2 Antibody
Target Information
- Target Protein: tryptase beta 2 (gene/pseudogene)
- Target Gene: TPSB2
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST)
- Sequence:
VKVPIMENHICDAKYHLGAYTGDDVRIVRD
- Sequence:
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Product Description
Polyclonal antibody against Human TPSB2.
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000018611 | 73% |
| Mouse | ENSMUSG00000024173 | 70% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative |
| MSDS | Material Safety Data Sheet |
Notes
- 사용 전 부드럽게 혼합하십시오.
- 각 응용 분야별 최적 농도 및 조건은 사용자가 직접 확인해야 합니다.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



