Atlas Antibodies Anti-TPSB2 Antibody

상품 한눈에 보기

Human TPSB2를 인식하는 폴리클로날 항체로, IHC 및 WB에 적합합니다. Rabbit에서 생산된 IgG 형식이며, PrEST 항원을 이용해 친화 정제되었습니다. 40% glycerol 기반 PBS 버퍼에 보존제로 sodium azide가 포함되어 있습니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA049153-100 Anti-TPSB2 Antibody, tryptase beta 2 (gene/pseudogene) 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA049153-25 Anti-TPSB2 Antibody, tryptase beta 2 (gene/pseudogene) 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target Protein: tryptase beta 2 (gene/pseudogene)
Target Gene: TPSB2
Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST)
- Sequence: VKVPIMENHICDAKYHLGAYTGDDVRIVRD

Polyclonal antibody against Human TPSB2.

Species	Gene ID	Sequence Identity
Rat	ENSRNOG00000018611	73%
Mouse	ENSMUSG00000024173	70%

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
MSDS	Material Safety Data Sheet