CacheBy
Atlas Antibodies Anti-TPP2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TPP2 Antibody

상품 한눈에 보기

Human TPP2 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB에 적합. Rabbit host 기반 IgG 형식이며 PrEST 항원을 이용해 친화 정제됨. Human, Mouse, Rat에서 높은 반응성을 검증받음. 안정한 PBS/glycerol buffer에 보존됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA049630-100 Anti-TPP2 Antibody, tripeptidyl peptidase II 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA049630-25 Anti-TPP2 Antibody, tripeptidyl peptidase II 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TPP2 Antibody

Anti-TPP2 Antibody

Target Information

  • Target Protein: Tripeptidyl peptidase II
  • Target Gene: TPP2
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
SSQANKLIKEELQSQVELLNSFEKKYSDPGPVYDCLVWHDGEVWRACIDSNEDGDLSKSTVLRNYKEAQEYGSFGTAEMLNYSVNIYDDGNLLSIVTSGGAHGTHVASIAAGHFPEEPERNGVAPGAQILSIKIGDTRLST

Verified Species Reactivity

Human, Mouse, Rat

Interspecies Information

Species Gene ID Sequence Identity
Rat ENSRNOG00000011194 97%
Mouse ENSMUSG00000041763 96%

Product Description

Polyclonal Antibody against Human TPP2
Open Datasheet

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand
  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.
  • Material Safety Data Sheet

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.