Atlas Antibodies Anti-TPO Antibody

상품 한눈에 보기

인체 TPO 단백질을 표적으로 하는 폴리클로날 항체로, IHC 및 RNA-seq 데이터 비교를 통한 Orthogonal Validation 제공. Rabbit 호스트에서 생산된 IgG 형태이며, PrEST 항원으로 친화 정제됨. Human 반응성 검증 완료.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA007987-100 Anti-TPO Antibody, thyroid peroxidase 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA007987-25 Anti-TPO Antibody, thyroid peroxidase 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: Thyroid Peroxidase (TPO)
Supplier: Atlas Antibodies

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Polyclonal antibody against human thyroid peroxidase (TPO).

TPX

항목	내용
Target Protein	Thyroid Peroxidase
Target Gene	TPO
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Identity	Mouse ENSMUSG00000020673 (77%), Rat ENSRNOG00000004646 (76%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using PrEST antigen as affinity ligand

RELEKHSLSRVICDNTGLTRVPMDAFQVGKFPEDFESCDSITGMNLEAWRETFPQDDKCGFPESVENGDFVHCEESGRRVLVYSCRHGYELQGREQLTCTQEGWDFQPPLCKDVNECADGA

Gently mix before use.
Optimal concentrations and conditions for each application should be determined by the user.
Material Safety Data Sheet (MSDS)

Enhanced Validation
IHC Orthogonal
Tooltip Orthogonal

0개

로그인하시면 이 상품에 대해 문의를 남길 수 있어요.

아직 등록된 문의가 없어요.