AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-TPMT Antibody
상품 한눈에 보기
인간 TPMT 단백질에 대한 폴리클로날 항체로, IHC 및 WB 실험에 적합합니다. Rabbit 유래 IgG 형식이며 PrEST 항원으로 정제되었습니다. PBS 및 글리세롤 기반 버퍼에 보존제가 포함되어 있습니다. TPMT 유전자 연구 및 단백질 발현 분석에 활용 가능합니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
ADADBIX 2026 전시회10/28~30 코엑스 · 사전등록 안내자세히보기Atlas Antibodies HPA019851-100 Anti-TPMT Antibody, thiopurine S-methyltransferase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA019851-25 Anti-TPMT Antibody, thiopurine S-methyltransferase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-TPMT Antibody
Anti-TPMT Antibody
Target: Thiopurine S-methyltransferase (TPMT)
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Product Description
Polyclonal antibody against human TPMT.
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Thiopurine S-methyltransferase |
| Target Gene | TPMT |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000021376 (71%), Rat ENSRNOG00000016468 (68%) |
Antigen Sequence:
ALVAINPGDRKCYADTMFSLLGKKFQYLLCVLSYDPTKHPGPPFYVPHAEIERLFGKICNIRCLEKVDAFEERHKSWGIDCL
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
Buffer Composition
| 성분 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.