CacheBy
Atlas Antibodies Anti-TP53TG5 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TP53TG5 Antibody

상품 한눈에 보기

인체 TP53TG5 단백질을 타겟으로 한 폴리클로날 토끼 항체. IHC 응용에 적합하며 RNA-seq 데이터 기반 Orthogonal 검증 완료. 고순도 Affinity 정제 방식으로 제조되어 높은 특이성과 재현성을 제공.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA041979-100 Anti-TP53TG5 Antibody, TP53 target 5 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA041979-25 Anti-TP53TG5 Antibody, TP53 target 5 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TP53TG5 Antibody

Anti-TP53TG5 Antibody

TP53 target 5

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal Antibody against Human TP53TG5

Alternative Gene Names

C20orf10, CLG01, dJ453C12.5

Open Datasheet

Target Information

항목 내용
Target Protein TP53 target 5
Target Gene TP53TG5
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000017720 (63%), Rat ENSRNOG00000026215 (57%)

Antigen Sequence:

SSLLKLLKSSNHRIQELHKLAKRCWHSLLSVPKILRISSGENSACNKTKQNNEEFQEIGCSEKELKSKKL

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.


제품 이미지

Enhanced Validation
IHC Orthogonal
Tooltip Orthogonal

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.