CacheBy
Atlas Antibodies Anti-TP73 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TP73 Antibody

상품 한눈에 보기

인간 TP73 단백질을 표적으로 하는 폴리클로날 항체로, WB 및 ICC 응용에 적합합니다. 토끼에서 생산된 IgG 항체이며 PrEST 항원으로 친화 정제되었습니다. 인간 반응성이 검증되었으며, 높은 종간 서열 일치를 보입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA027314-100 Anti-TP73 Antibody, tumor protein p73 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA027314-25 Anti-TP73 Antibody, tumor protein p73 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TP73 Antibody

Anti-TP73 Antibody

Target Information

  • Target Protein: Tumor protein p73
  • Target Gene: TP73
  • Alternative Gene Name: P73
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human TP73.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

RQQQQLLQRPSHLQPPSYGPVLSPMNKVHGGMNKLPSVNQLVGQPPPHSSAATPNLGPVGPGMLNNHGHAVPANGEMSSSHSAQSMVSGSHCTPPP

Verified Species Reactivity

  • Human

Interspecies Information

Species Ortholog ID Sequence Identity
Mouse ENSMUSG00000029026 86%
Rat ENSRNOG00000024707 83%

Antibody Characteristics

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
Purification Method Affinity purified using PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.