Atlas Antibodies Anti-TOMM20 Antibody
| 상품 옵션 정보 | ||||||||
|---|---|---|---|---|---|---|---|---|
| 카탈로그 번호 | CAS 번호 | 설명 | 상태 | 단위 | 판매가 | 할인가 | 가격(VAT포함) | 수량 / 장바구니 / 찜 |
| HPA011562-100 | - | Atlas Antibodies HPA011562-100 Anti-TOMM20 Antibody, translocase of outer mitochondrial membrane 20 homolog (yeast) 100ul | 재고문의 | 100ul | 728,000원 | - | 800,800원 | |
| HPA011562-25 | - | Atlas Antibodies HPA011562-25 Anti-TOMM20 Antibody, translocase of outer mitochondrial membrane 20 homolog (yeast) 25ul | 재고문의 | 25ul | 528,000원 | - | 580,800원 | |
다른 상품 둘러보기
Anti-TOMM20 Antibody
translocase of outer mitochondrial membrane 20 homolog (yeast)
Recommended Applications
Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
Product Description
Polyclonal Antibody against Human TOMM20
Alternative Gene Names
KIAA0016, MAS20, MOM19, TOM20
Target Protein
translocase of outer mitochondrial membrane 20 homolog (yeast)
Target Gene
TOMM20
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Copy sequence to clipboard
KRRSDPNFKNRLRERRKKQKLAKERAGLSKLPDLKDAEAVQKFFLEEIQLGEELLAQGEYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKLPTISQRIVSAQSLAEDDV
Verified Species Reactivity
Human, Mouse
Interspecies Information
Highest antigen sequence identity to the following orthologs:
Rat ENSRNOG00000019980 (99%)
Mouse ENSMUSG00000093904 (99%)
Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. [Material Safety Data Sheet](https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf Material Safety Data Sheet)
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제 방법 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|