Atlas Antibodies Anti-TNFRSF10A Antibody
| 상품 옵션 정보 | ||||||||
|---|---|---|---|---|---|---|---|---|
| 카탈로그 번호 | CAS 번호 | 설명 | 상태 | 단위 | 판매가 | 할인가 | 가격(VAT포함) | 수량 / 장바구니 / 찜 |
| HPA054475-100 | - | Atlas Antibodies HPA054475-100 Anti-TNFRSF10A Antibody, tumor necrosis factor receptor superfamily, member 10a 100ul | 재고문의 | 100ul | 728,000원 | - | 800,800원 | |
| HPA054475-25 | - | Atlas Antibodies HPA054475-25 Anti-TNFRSF10A Antibody, tumor necrosis factor receptor superfamily, member 10a 25ul | 재고문의 | 25ul | 528,000원 | - | 580,800원 | |
다른 상품 둘러보기
Anti-TNFRSF10A Antibody
tumor necrosis factor receptor superfamily, member 10a
Recommended Applications
Product Description
Polyclonal Antibody against Human TNFRSF10A
Alternative Gene Names
Apo2, CD261, DR4, TRAILR-1
Target Protein
tumor necrosis factor receptor superfamily, member 10a
Target Gene
TNFRSF10A
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Copy sequence to clipboard
ATPSKVWGSSAGRIEPRGGGRGALPTSMGQHGPSA
Verified Species Reactivity
Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
Rat ENSRNOG00000009863 (44%)
Mouse ENSMUSG00000034164 (37%)
Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. [Material Safety Data Sheet](https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf Material Safety Data Sheet)
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제 방법 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|