CacheBy
Atlas Antibodies Anti-GALNT1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-GALNT1 Antibody

상품 한눈에 보기

Human GALNT1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 Western Blot에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 종간 보존성을 보여 인간, 생쥐, 랫드에서 반응합니다. 안정한 PBS/glycerol 버퍼에 보존되어 있습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA012628-100 Anti-GALNT1 Antibody, polypeptide N-acetylgalactosaminyltransferase 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA012628-25 Anti-GALNT1 Antibody, polypeptide N-acetylgalactosaminyltransferase 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-GALNT1 Antibody

Anti-GALNT1 Antibody

Target: polypeptide N-acetylgalactosaminyltransferase 1 (GALNT1)
Type: Polyclonal Antibody against Human GALNT1


  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody raised in rabbit against human GALNT1 (polypeptide N-acetylgalactosaminyltransferase 1).


Alternative Gene Names

  • GalNAc-T1

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein polypeptide N-acetylgalactosaminyltransferase 1
Target Gene GALNT1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence KERGLPAGDVLEPVQKPHEGPGEMGKPVVIPKEDQEKMKEMFKINQFNLMASEMIALNRSLPD
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000000420 (97%), Rat ENSRNOG00000016207 (97%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide as preservative (MSDS)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC
WB

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.