CacheBy
Atlas Antibodies Anti-GALNT15 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-GALNT15 Antibody

상품 한눈에 보기

Human GALNT15 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 ICC 응용에 적합. PrEST 항원을 이용해 친화 정제됨. Human에 반응하며 Mouse 및 Rat과 유사성 있음. 40% 글리세롤/PBS 완충액에 보존됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA017076-100 Anti-GALNT15 Antibody, polypeptide N-acetylgalactosaminyltransferase 15 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA017076-25 Anti-GALNT15 Antibody, polypeptide N-acetylgalactosaminyltransferase 15 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-GALNT15 Antibody

Anti-GALNT15 Antibody

Target: polypeptide N-acetylgalactosaminyltransferase 15
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human GALNT15.


Alternative Gene Names

GALNT7, GALNTL2, pp-GalNAc-T15

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein polypeptide N-acetylgalactosaminyltransferase 15
Target Gene GALNT15
Antigen Sequence Type Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence GGSVEILPCSRVGHIYQNQDSHSPLDQEATLRNRVRIAETWLGSFKETFYKHSPEAFSLSKAEKPDCMERLQLQRRLGCRTFHWFLANVYPELYPSEPRPSFSGKLHNTGLG

Species Reactivity

항목 내용
Verified Reactivity Human
Ortholog Identity Mouse ENSMUSG00000021903 (78%), Rat ENSRNOG00000019718 (61%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using PrEST antigen as affinity ligand

Buffer Composition

구성 성분 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC Application
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.