CacheBy
Atlas Antibodies Anti-GALM Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-GALM Antibody

상품 한눈에 보기

Human GALM 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 기반 정량 및 RNA-seq 데이터 비교를 통한 정교한 Orthogonal 검증 수행. Affinity purified 방식으로 높은 특이성과 재현성 제공. 다양한 조직 연구 및 단백질 발현 분석에 적합.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA035472-100 Anti-GALM Antibody, galactose mutarotase (aldose 1-epimerase) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA035472-25 Anti-GALM Antibody, galactose mutarotase (aldose 1-epimerase) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-GALM Antibody

Anti-GALM Antibody

Target: galactose mutarotase (aldose 1-epimerase)
Supplier: Atlas Antibodies


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal antibody against Human GALM.
Open Datasheet (PDF)


Target Information

항목 내용
Target Protein galactose mutarotase (aldose 1-epimerase)
Target Gene GALM
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence YPGELKVWVTYTLDGGELIVNYRAQASQATPVNLTNHSYFNLAGQASPNINDHEVTIEADTYLPVDETLIPTGEVAPVQGTAFDLRK
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000007023 (89%), Mouse ENSMUSG00000035473 (89%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.