CacheBy
Atlas Antibodies Anti-GABRD Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-GABRD Antibody

상품 한눈에 보기

Human GABRD 단백질을 인식하는 토끼 폴리클로날 항체로, IHC를 통한 단백질 발현 검증에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공. 인체 및 설치류와 교차 반응성이 확인됨. 연구용으로 권장.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA044371-100 Anti-GABRD Antibody, gamma-aminobutyric acid (GABA) A receptor, delta 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA044371-25 Anti-GABRD Antibody, gamma-aminobutyric acid (GABA) A receptor, delta 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-GABRD Antibody

Anti-GABRD Antibody

Target: gamma-aminobutyric acid (GABA) A receptor, delta
Supplier: Atlas Antibodies


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal antibody against Human GABRD.
Open Datasheet (PDF)


Target Information

항목 내용
Target Protein gamma-aminobutyric acid (GABA) A receptor, delta
Target Gene GABRD
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence KVKVSRPRAEMDVRNAIVLFSLSAAGVTQELAISRRQRRVPGNLMGSYRSVGVETGETKKEGAARSGGQGGIRARL
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000016385 (82%), Mouse ENSMUSG00000029054 (82%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

구성 성분 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
Recommended Application - IHC Orthogonal
Orthogonal Validation Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.