CacheBy
Atlas Antibodies Anti-GABRG1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-GABRG1 Antibody

상품 한눈에 보기

Human GABRG1 단백질을 인식하는 토끼 폴리클로날 항체로, GABA A 수용체 감마1 서브유닛 검출에 사용됩니다. IHC 등 다양한 응용에 적합하며, PrEST 항원을 이용해 친화 정제되었습니다. 인간에 대해 검증된 반응성을 가집니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA035622-100 Anti-GABRG1 Antibody, gamma-aminobutyric acid (GABA) A receptor, gamma 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA035622-25 Anti-GABRG1 Antibody, gamma-aminobutyric acid (GABA) A receptor, gamma 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-GABRG1 Antibody

Anti-GABRG1 Antibody

Target: gamma-aminobutyric acid (GABA) A receptor, gamma 1
Type: Polyclonal Antibody against Human GABRG1

면역조직화학(IHC) 등 다양한 연구용 응용에 적합합니다.

Product Description

Polyclonal antibody raised in rabbit against human GABRG1 (gamma-aminobutyric acid (GABA) A receptor, gamma 1).
Open Datasheet

Target Information

항목 내용
Target Protein gamma-aminobutyric acid (GABA) A receptor, gamma 1
Target Gene GABRG1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence RGVRLVFLLLTLHLGNCVDKADDEDDEDLTVNKTWVLAPKIHEGDITQIL
Verified Species Reactivity Human
Interspecies Identity Mouse (96%), Rat (94%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer

40% glycerol and PBS (pH 7.2) with 0.02% sodium azide as preservative.
Material Safety Data Sheet

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용에 최적의 농도와 조건은 사용자가 직접 결정해야 합니다.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.