원본

Atlas Antibodies Anti-GABRB2 Antibody

상품 한눈에 보기

Human GABRB2 단백질을 인식하는 토끼 폴리클로날 항체로, IHC Orthogonal 검증 완료. Affinity purified 방식으로 높은 특이성과 재현성을 제공하며, RNA-seq 데이터 기반 Orthogonal validation으로 신뢰성 향상. 인체 시료 연구용으로 적합.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA067632-100 Anti-GABRB2 Antibody, gamma-aminobutyric acid (GABA) A receptor, beta 2 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA067632-25 Anti-GABRB2 Antibody, gamma-aminobutyric acid (GABA) A receptor, beta 2 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-GABRB2 Antibody

Anti-GABRB2 Antibody

Target: gamma-aminobutyric acid (GABA) A receptor, beta 2
Supplier: Atlas Antibodies

Recommended Applications

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal Antibody against Human GABRB2
Open Datasheet (PDF)

Target Information

항목	내용
Target Protein	gamma-aminobutyric acid (GABA) A receptor, beta 2
Target Gene	GABRB2
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	STLEIKNEMATSEAVMGLGDPRSTMLAYDASSIQYRKAGLPRHSFGRNALERHVAQKKSR
Verified Species Reactivity	Human
Interspecies Identity	Rat ENSRNOG00000003680 (100%), Mouse ENSMUSG00000007653 (100%)

Antibody Characteristics

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2) with 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand