CacheBy
Atlas Antibodies Anti-GABRB2 Antibody
원본

Atlas Antibodies Anti-GABRB2 Antibody

상품 한눈에 보기

Human GABRB2 단백질을 인식하는 토끼 폴리클로날 항체로, IHC Orthogonal 검증 완료. Affinity purified 방식으로 높은 특이성과 재현성을 제공하며, RNA-seq 데이터 기반 Orthogonal validation으로 신뢰성 향상. 인체 시료 연구용으로 적합.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA067632-100 Anti-GABRB2 Antibody, gamma-aminobutyric acid (GABA) A receptor, beta 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA067632-25 Anti-GABRB2 Antibody, gamma-aminobutyric acid (GABA) A receptor, beta 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-GABRB2 Antibody

Anti-GABRB2 Antibody

Target: gamma-aminobutyric acid (GABA) A receptor, beta 2
Supplier: Atlas Antibodies


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal Antibody against Human GABRB2
Open Datasheet (PDF)


Target Information

항목 내용
Target Protein gamma-aminobutyric acid (GABA) A receptor, beta 2
Target Gene GABRB2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence STLEIKNEMATSEAVMGLGDPRSTMLAYDASSIQYRKAGLPRHSFGRNALERHVAQKKSR
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000003680 (100%), Mouse ENSMUSG00000007653 (100%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Validation Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.