CacheBy
Atlas Antibodies Anti-TMTC4 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TMTC4 Antibody

상품 한눈에 보기

Human TMTC4 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산된 IgG 형식입니다. IHC 및 ICC 등 다양한 응용에 적합하며, PrEST 항원으로 친화 정제되었습니다. Human에 반응성이 검증되었으며, 높은 종간 서열 유사성을 가집니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA057056-100 Anti-TMTC4 Antibody, transmembrane and tetratricopeptide repeat containing 4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA057056-25 Anti-TMTC4 Antibody, transmembrane and tetratricopeptide repeat containing 4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TMTC4 Antibody

Anti-TMTC4 Antibody

Target: transmembrane and tetratricopeptide repeat containing 4 (TMTC4)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human TMTC4.


Alternative Gene Names

  • FLJ14624
  • FLJ22153

Open Datasheet


Target Information

항목 내용
Target Protein transmembrane and tetratricopeptide repeat containing 4
Target Gene TMTC4
Verified Species Reactivity Human
Interspecies Identity Mouse (96%), Rat (94%)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

NLGRLYADLNRHVDALNAWRNATVLKPEHSLAWNNMIILLDNTGNLAQAEAVGREALELIPNDHSLMFSLANVLGKSQKYKESEALFLKAIKANPNAASYHGNLAVLYHRWGHLDLAKKHYEISLQLDPTASGTKENYGLLR


Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.