CacheBy
Atlas Antibodies Anti-TMTC2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TMTC2 Antibody

상품 한눈에 보기

Human TMTC2 단백질을 인식하는 Rabbit Polyclonal Antibody. IHC, WB, ICC 등 다양한 응용에 적합. PrEST 항원을 이용한 친화 정제. Human, Mouse, Rat 반응성 검증 완료. 안정한 PBS/glycerol buffer로 보존.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA026954-100 Anti-TMTC2 Antibody, transmembrane and tetratricopeptide repeat containing 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA026954-25 Anti-TMTC2 Antibody, transmembrane and tetratricopeptide repeat containing 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TMTC2 Antibody

Anti-TMTC2 Antibody

Target: transmembrane and tetratricopeptide repeat containing 2 (TMTC2)
Type: Polyclonal Antibody against Human TMTC2
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody raised in rabbit against Human TMTC2 protein.


Alternative Gene Names

  • DKFZp762A217

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein transmembrane and tetratricopeptide repeat containing 2
Target Gene TMTC2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human, Mouse, Rat
Interspecies Identity Mouse ENSMUSG00000036019 (97%), Rat ENSRNOG00000004585 (94%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), with 0.02% sodium azide preservative (Material Safety Data Sheet)

Antigen Sequence

MMGEAYMRLSKLPEAEHWYMESLRSKTDHIPAHLTYGKLLALTGRKSEAEKLFLKAIELDPTKGNCYMHYGQFLLEEARLIEAAEMAKKAAELDSTEFDVVFNAAHMLRQASLNEAAEKYYDLAARLRPNYPAALMNLGAIL


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.