CacheBy
Atlas Antibodies Anti-TMTC3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TMTC3 Antibody

상품 한눈에 보기

Human TMTC3 단백질을 표적으로 하는 폴리클로날 항체로, Rabbit 호스트에서 생산. IHC 등 다양한 응용에 적합하며, PrEST 항원을 이용해 친화 정제됨. 인간에 대해 검증된 반응성을 가지며, 높은 종간 서열 유사성 보유.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA038550-100 Anti-TMTC3 Antibody, transmembrane and tetratricopeptide repeat containing 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA038550-25 Anti-TMTC3 Antibody, transmembrane and tetratricopeptide repeat containing 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TMTC3 Antibody

Anti-TMTC3 Antibody

Target: Transmembrane and tetratricopeptide repeat containing 3 (TMTC3)
Supplier: Atlas Antibodies


면역조직화학(IHC)


Product Description

Polyclonal Antibody against Human TMTC3


Alternative Gene Names

FLJ90492, SMILE

Open Datasheet


Target Information

항목 내용
Target Protein Transmembrane and tetratricopeptide repeat containing 3
Target Gene TMTC3
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000036676 (98%), Rat ENSRNOG00000006749 (95%)

Antigen Sequence:
RQAISMRPDFKQAYISRGELLLKMNKPLKAKEAYLKALELDRNNADLWYNLAIVHIELKEPNEALKNFNRALELNPKHKLALFNSAIVMQESGE


Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용에 대한 최적 농도와 조건은 사용자가 직접 결정해야 합니다.

제품 이미지

IHC Recommended Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.