
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-TMTC3 Antibody
상품 한눈에 보기
Human TMTC3 단백질을 표적으로 하는 폴리클로날 항체로, Rabbit 호스트에서 생산. IHC 등 다양한 응용에 적합하며, PrEST 항원을 이용해 친화 정제됨. 인간에 대해 검증된 반응성을 가지며, 높은 종간 서열 유사성 보유.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA038550-100 Anti-TMTC3 Antibody, transmembrane and tetratricopeptide repeat containing 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA038550-25 Anti-TMTC3 Antibody, transmembrane and tetratricopeptide repeat containing 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-TMTC3 Antibody
Anti-TMTC3 Antibody
Target: Transmembrane and tetratricopeptide repeat containing 3 (TMTC3)
Supplier: Atlas Antibodies
Recommended Applications
면역조직화학(IHC)
Product Description
Polyclonal Antibody against Human TMTC3
Alternative Gene Names
FLJ90492, SMILE
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Transmembrane and tetratricopeptide repeat containing 3 |
| Target Gene | TMTC3 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Information | Mouse ENSMUSG00000036676 (98%), Rat ENSRNOG00000006749 (95%) |
Antigen Sequence:
RQAISMRPDFKQAYISRGELLLKMNKPLKAKEAYLKALELDRNNADLWYNLAIVHIELKEPNEALKNFNRALELNPKHKLALFNSAIVMQESGE
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- 사용 전 부드럽게 혼합하십시오.
- 각 응용에 대한 최적 농도와 조건은 사용자가 직접 결정해야 합니다.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



